PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00077984001
Common NameGSBRNA2T00077984001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family RAV
Protein Properties Length: 666aa    MW: 73649.3 Da    PI: 7.4639
Description RAV family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00077984001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP241.33.8e-1364112155
                  AP2   1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 
                          s++kGV   + +grW A+I++      ++r++lg+f  +eeAa+a++ a+ +++g
  GSBRNA2T00077984001  64 SRFKGVVPQP-NGRWGAQIYEK-----HQRVWLGTFNEEEEAARAYDVAAHRFRG 112
                          6899**9788.8*********3.....5************************998 PP

2B367.91.4e-212002683199
                          .--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                           +++ l +ed +g++W+++++y+++s++yvltkGW++Fvk+++L++gD + Fk+++ ++++l++++ +k
  GSBRNA2T00077984001 200 VRGTLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKRLCAGDLISFKRSNGQDQQLYIGWKSK 268
                          5678899**********************************************9877999999999776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008472.1E-864112IPR001471AP2/ERF domain
CDDcd000182.99E-2664122No hitNo description
SuperFamilySSF541713.14E-1764121IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.102.7E-2065120IPR001471AP2/ERF domain
SMARTSM003802.7E-2865126IPR001471AP2/ERF domain
PROSITE profilePS5103220.38965120IPR001471AP2/ERF domain
CDDcd100172.58E-15188256No hitNo description
SuperFamilySSF1019361.19E-18189272IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.0E-9189269IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-22201272IPR015300DNA-binding pseudobarrel domain
PfamPF023623.4E-18201268IPR003340B3 DNA binding domain
PROSITE profilePS5086311.434205269IPR003340B3 DNA binding domain
HamapMF_0197436.635419665IPR002467Peptidase M24A, methionine aminopeptidase, subfamily 1
TIGRFAMsTIGR005001.6E-77425664IPR002467Peptidase M24A, methionine aminopeptidase, subfamily 1
Gene3DG3DSA:3.90.230.101.8E-85425664IPR000994Peptidase M24, structural domain
SuperFamilySSF559207.2E-74427663IPR000994Peptidase M24, structural domain
CDDcd010861.90E-120427663No hitNo description
PfamPF005576.2E-49429656IPR000994Peptidase M24, structural domain
PRINTSPR005991.0E-14484497IPR001714Peptidase M24, methionine aminopeptidase
PRINTSPR005991.0E-14506522IPR001714Peptidase M24, methionine aminopeptidase
PRINTSPR005991.0E-14575587IPR001714Peptidase M24, methionine aminopeptidase
PRINTSPR005991.0E-14607619IPR001714Peptidase M24, methionine aminopeptidase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006508Biological Processproteolysis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004177Molecular Functionaminopeptidase activity
GO:0008235Molecular Functionmetalloexopeptidase activity
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MDAASSVDES STSTDSVHTP AKIPPATARK SPSPASLYRM GSGSSVVLDS ENGVEAESRK  60
LPSSRFKGVV PQPNGRWGAQ IYEKHQRVWL GTFNEEEEAA RAYDVAAHRF RGRDAVTNFK  120
ADTTLGNGDE VEFLNAHSKA EIVDMLRKHT YKEELEQRKR NLHGKGNTKE TAFAAVRVAT  180
GFKTAETLFE KAVTPRDVSV RGTLLNFEDV NGKVWRFRYS YWNSSQSYVL TKGWSRFVKE  240
KRLCAGDLIS FKRSNGQDQQ LYIGWKSKSE SDQDTGRVVV RLFGVDITSL KSQSDVVMKE  300
ETEMLSLRCN KKQRLNVPAK MSFGISQSHS LFNGGQLTPP IYFAGAPANL SSLLLSVKKK  360
KSSFSPRISR IQELQNTLQV KRNAPLVCGR VSPRLHVPDH IPKAPYLESS EPPKISSEHQ  420
FPDSNGIVKM KAACELAARV LNYAGTLVKP FVTTDEIDKA VHKMVIESGA YPSPLGYGGF  480
PKSVCTSVNE CMFHGVPDSR QLQDGDIINI DVAVYLDGYH GDTSKTFLCG DVDESLVQLV  540
KVTEECLEKG ISVCRDGASF NEIGKIISEH AEKHGYNMER FIGHGVGTVL HSEPLIYLHK  600
NYDFEIGYMI EGQTFTLEPI LTIGTTEFVT WPDKWTILTA DGGPAAQFEH TILITESGAE  660
ILTTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4u6w_A4e-7439166313292Methionine aminopeptidase 1
4u6z_A4e-7439166313292Methionine aminopeptidase 1
4u70_A4e-7439166313292Methionine aminopeptidase 1
4u71_A4e-7439166313292Methionine aminopeptidase 1
4u73_A4e-7439166313292Methionine aminopeptidase 1
4u75_A4e-7439166313292Methionine aminopeptidase 1
4u76_A4e-7439166313292Methionine aminopeptidase 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.231240.0flower
Functional Description ? help Back to Top
Source Description
UniProtRemoves the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). {ECO:0000256|RuleBase:RU003653}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00077984001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4414685e-71FJ441468.1 Arabidopsis thaliana clone E At3g25740 gene, partial sequence.
GenBankFJ4414695e-71FJ441469.1 Arabidopsis thaliana clone L At3g25740 gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292936.10.0hypothetical protein CARUB_v10019207mg
SwissprotQ9FV510.0MAP1C_ARATH; Methionine aminopeptidase 1C, chloroplastic/mitochondrial
TrEMBLA0A078FKC20.0A0A078FKC2_BRANA; Methionine aminopeptidase
STRINGBra025159.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM439133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25730.11e-148ethylene response DNA binding factor 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]